Author |
Message |
Bloodlight
New Peasant
Joined: January 14th, 2007, 7:06 pm Posts: 31
|
 long words
what is the longest word you know
mine is ,, antidisestablishmentarianism
_________________
 
 
BloodLight, The power i have is beyond imagination
|
January 17th, 2007, 7:42 pm |
|
 |
Guardian Angel
Peasant Elder
Joined: January 15th, 2007, 2:28 pm Posts: 131
Gender: Guy
Affiliation: Elves
|
zandzeepsodemineraalwatersteenstralen 37 letters,
but it's dutch lol (my native language  )
|
January 17th, 2007, 8:31 pm |
|
 |
rpm12345
Pink Dragon
Joined: October 12th, 2006, 12:25 am Posts: 6215 Location: MA
Gender: Guy
Affiliation: Dragonriders
|
Guardian Angel wrote: zandzeepsodemineraalwatersteenstralen 37 letters, but it's dutch lol (my native language  ) what does it mean?
_________________
 metal gear forever
|
January 17th, 2007, 8:32 pm |
|
 |
Guardian Angel
Peasant Elder
Joined: January 15th, 2007, 2:28 pm Posts: 131
Gender: Guy
Affiliation: Elves
|
I have absolutely no idea, lol, I just happen to know
that that IS the longest word in our language..
Not the longest I know of, but actually the longest word.. 
|
January 17th, 2007, 8:36 pm |
|
 |
Bloodlight
New Peasant
Joined: January 14th, 2007, 7:06 pm Posts: 31
|
wow, that is a long word
_________________
 
 
BloodLight, The power i have is beyond imagination
|
January 18th, 2007, 4:05 pm |
|
 |
ladyofthelost
DragonRider
Joined: October 17th, 2006, 5:56 pm Posts: 854 Location: somewhere, there's no gravity, and common sense has died, guess where i am cause i don't have a clue
|
floccinaucinihilipilifition is the longest word in the english language
antidisestablishmentarianism is not actually a word...
just saying
_________________ Where the gods fear to tread
That where evil makes its bed
That is where they grow and grow
and that is where you must go
(\../)
(O.o)
(")(")
Help me take over the world!!!
we took a wrong turning
it's nobodies fault
we followed our hearts
and now we're lost
we kept on going
no thought of cost
and this is the consequence
please read and comment on my story
http://www.saphiraforums.com/en/viewtopic.php?t=3206
please read and comment on my songs
http://www.saphiraforums.com/en/viewtopic.php?t=4283
Aren't i demanding
after several painful attempts i stopped getting Vivi!!!
Which Final Fantasy Character Are You?
Final Fantasy 7
|
January 18th, 2007, 5:19 pm |
|
 |
chimra922
Sovereign DragonRider
Joined: August 21st, 2006, 10:51 pm Posts: 3802 Location: in the eye of the beholder
Gender: Girl
Affiliation: Elves
|
the longest word is actually 1909 letters long but it is not on wikipiedia and i dont feel like typing it but the deffinition is : A tryptophan synthetase A protein, an enzyme that has 267 amino acids : since the longest word is so long i will put anouther long word
floccinaucinhilpilification - means the estimation of a thing that is worthless
Quote: antidisestablishmentarianism is not actually a word...
it is so a word it is in my dictionary!!! and its on wikipeidia if u do not belive me here is the link
http://en.wikipedia.org/wiki/Antidisestablishmentarianism
|
January 18th, 2007, 8:24 pm |
|
 |
Bloodlight
New Peasant
Joined: January 14th, 2007, 7:06 pm Posts: 31
|
thank you for proving that my word was real  . i donated 10 coins for that:D
_________________
 
 
BloodLight, The power i have is beyond imagination
|
January 18th, 2007, 9:35 pm |
|
 |
littleboo85
DragonRider in Training
Joined: November 25th, 2006, 5:50 am Posts: 634 Location: Would love to be at the races at the 24 hours of daytona...god it is that time of the year again????
Gender: Guy
|
supercalafigalistxbaladouish mary poppen's
_________________

Take the Magic: The Gathering 'What Color Are You?' Quiz.i zoom zoom! do you? Mazda 3's rock!
|
January 19th, 2007, 4:42 am |
|
 |
arya_shur'tugal
Wise DragonRider
Joined: July 26th, 2006, 8:45 am Posts: 1229 Location: Somewhere scary, listening to MCR, SOAD and other emo bands. But not cutting myself..
Gender: Guy
Affiliation: Dwarves
|
thats not how you spell mary poppins lol
otorhinolaryngological (22 letters),
immunoelectrophoretically (25 letters),
psychophysicotherapeutics (25 letters),
thyroparathyroidectomized (25 letters),
pneumoencephalographically (26 letters),
radioimmunoelectrophoresis (26 letters),
psychoneuroendocrinological (27 letters)
hepaticocholangiogastrostomy (28 letters),
spectrophotofluorometrically (28 letters),
pseudopseudohypoparathyroidism (30 letters).
floccinaucinihilipilification (29 letters),
and anyway, wikipedia is not always right...
_________________
Arya Svit-kona wrote: caterpillar SILVER I JUST NOTICED THE CHEST HAIR!!!!!!!
The Lovable Silv wrote: LOL Ranga, you cannot steal my position as "Bullspit artist" so stop being so sarcastic haha!! Jking of course..
 The Lovechild of Valk and Wolverein
.[/color]
|
January 19th, 2007, 5:57 am |
|
 |
ladyofthelost
DragonRider
Joined: October 17th, 2006, 5:56 pm Posts: 854 Location: somewhere, there's no gravity, and common sense has died, guess where i am cause i don't have a clue
|
according to someone who knows a lot about languages and came to talk to us about said languages it's not a word...
_________________ Where the gods fear to tread
That where evil makes its bed
That is where they grow and grow
and that is where you must go
(\../)
(O.o)
(")(")
Help me take over the world!!!
we took a wrong turning
it's nobodies fault
we followed our hearts
and now we're lost
we kept on going
no thought of cost
and this is the consequence
please read and comment on my story
http://www.saphiraforums.com/en/viewtopic.php?t=3206
please read and comment on my songs
http://www.saphiraforums.com/en/viewtopic.php?t=4283
Aren't i demanding
after several painful attempts i stopped getting Vivi!!!
Which Final Fantasy Character Are You?
Final Fantasy 7
|
January 19th, 2007, 4:36 pm |
|
 |
Fastfire21
Dragon Egg Carrier
Joined: December 20th, 2006, 5:37 pm Posts: 153 Location: On a football field, playing football, or watching football.
|
NONE OF THOSE ARE IT. most arent even words. the longest word in the english language is:
Pnuemonoultramicroscopicsilacovolcanoconiosis. 45 letters. scientific for black lung disease.
_________________
LT is the man.
If we knew all of gods reasons for doing things, then we would be god.
You cry, I cry
You laugh, I laugh
I fall off a bridge, you laugh even harder.
If your not going to say anything nice, at least make it funny.
Hey did you guys know I like football?
A good friend will bail you out of jail, but a best friend will be sitting right next to you, saying, "MAN! that was fun!"
Arya is HOT! (but not in the movie)
Never tell me the odds...
|
January 19th, 2007, 5:20 pm |
|
 |
blue sword
BAD EMAIL
Joined: August 10th, 2006, 10:15 pm Posts: 279 Location: where the side walk ends
|
I heard the same thing from my 7th grade L. Arts teacher
_________________ "Strength does not come from physical capsity. It comes from indomitable will." Ghandi
Which Final Fantasy Character Are You?
Final Fantasy
|
January 19th, 2007, 5:53 pm |
|
 |
arya_shur'tugal
Wise DragonRider
Joined: July 26th, 2006, 8:45 am Posts: 1229 Location: Somewhere scary, listening to MCR, SOAD and other emo bands. But not cutting myself..
Gender: Guy
Affiliation: Dwarves
|
my friends say that antidisastablishmentarianism is a word, but they're full of it!
_________________
Arya Svit-kona wrote: caterpillar SILVER I JUST NOTICED THE CHEST HAIR!!!!!!!
The Lovable Silv wrote: LOL Ranga, you cannot steal my position as "Bullspit artist" so stop being so sarcastic haha!! Jking of course..
 The Lovechild of Valk and Wolverein
.[/color]
|
January 20th, 2007, 1:11 am |
|
 |
Shade of Fear
RPG Team Head
Joined: February 6th, 2006, 11:51 pm Posts: 4527 Location: Dreaming.
Gender: Guy
Affiliation: Lamp Shade
Dragon: DrAgonPhD
|
Lopadotemachoselachogaleokranioleipsanodrimhypotrimmatosilphioparaomelitokatak
echymenokichlepikossyphophattoperisteralektryonoptekephalliokigklopeleiolagoiosira
iobaphetraganopterygon
189 letters lol
|
January 20th, 2007, 3:03 am |
|
 |
littleboo85
DragonRider in Training
Joined: November 25th, 2006, 5:50 am Posts: 634 Location: Would love to be at the races at the 24 hours of daytona...god it is that time of the year again????
Gender: Guy
|
tristadicaphiobia (sp)
_________________

Take the Magic: The Gathering 'What Color Are You?' Quiz.i zoom zoom! do you? Mazda 3's rock!
|
January 20th, 2007, 4:00 am |
|
 |
chimra922
Sovereign DragonRider
Joined: August 21st, 2006, 10:51 pm Posts: 3802 Location: in the eye of the beholder
Gender: Girl
Affiliation: Elves
|
Fastfire21 wrote: NONE OF THOSE ARE IT. most arent even words. the longest word in the english language is: Pnuemonoultramicroscopicsilacovolcanoconiosis. 45 letters. scientific for black lung disease.
u must not have read my last post the longest word is 1909 letters long
|
January 21st, 2007, 2:01 am |
|
 |
Dragonzroc
Wise DragonRider
Joined: August 21st, 2006, 10:04 am Posts: 1196 Location: Somewhere in England wishing for good weather....
Gender: Girl
Affiliation: SF Rebels
|
Fastfire21 wrote: NONE OF THOSE ARE IT. most arent even words. the longest word in the english language is: Pnuemonoultramicroscopicsilacovolcanoconiosis. 45 letters. scientific for black lung disease.
actually it means the dust particles in the lung. or something along those lines not black lung deasise(unless tere the same thign then sori lol!!)
_________________ Oh No of course!You must have worked hands free, like Hey I'm the doctor I can save the universe using a kettle and some string, and look at me im wearing a vegetable- David Tennant
|
January 21st, 2007, 11:18 am |
|
 |
Bloodlight
New Peasant
Joined: January 14th, 2007, 7:06 pm Posts: 31
|
btw, antidis..... is a word, cos microsoft word has it in its internal dictionary, if u spell it wrong it tell u how to spell it correctly, and if u spell it right it do not put a red line under it
_________________
 
 
BloodLight, The power i have is beyond imagination
|
January 21st, 2007, 12:16 pm |
|
 |
dark dragon
RPG Team
Joined: August 21st, 2006, 9:28 pm Posts: 8122 Location: I don't know, how could you expect me to when it was you who brought me here!
Gender: Guy
Affiliation: Dragonriders
Dragon: Avadius
|
nordostersjakustartillerflygspaningssimulatoranlaggningsmarterielunderhallsuppfoljingsystemdisikussionsinlaggstorberedelse its a 130 letter word in swedish
_________________ Good: Equinox Eris/Galedrim Aaron Ephidel Tvashtar Savania Incendia Radenya Zeuk Quasar Nainocaro Alex Archayac Sahara
Neutral: Snare
Evil: Crimson Dsurion Demondred "Destroyer of Hope" Solstus "Dragon of the Night"
Let your spirit flow in each and everyone one of us and may we bask in your forgiveness, love, and mercy.
|
January 21st, 2007, 11:40 pm |
|
 |
bammmbanggg
Wise DragonRider
Joined: March 17th, 2007, 5:12 pm Posts: 1199 Location: Relient K concert
|
Pneumonoultramicroscopicsilicovolcanoconiosis
45 letters its some thing to do with lung disease
_________________ A good friend will bail you out of jail, but a best friend will be sitting right next to you, saying, "MAN! that was fun!"
yo, i like skaterboarding
|
March 18th, 2007, 1:54 pm |
|
 |
mdf92
Dragon Egg Carrier
Joined: December 8th, 2006, 1:27 am Posts: 171
|
For short it's also Miner's Lung.
how about smiles, because there's a mile between the first and last letters.
_________________ There is nothing more dangerous than an enemy with nothing to lose... and that is exactly what I have become. -Eragon in Eragon
There are no failures, only opportunities, -Queen Savilla in The Outstretched Shadow
People fear what they don't understand.
There comes a time when everyone must do something they fear
Which Final Fantasy Character Are You?
Final Fantasy 7
|
March 18th, 2007, 1:57 pm |
|
 |
bammmbanggg
Wise DragonRider
Joined: March 17th, 2007, 5:12 pm Posts: 1199 Location: Relient K concert
|
REAL WORD....
Swedish
80 letters
kyyhkyslakkahillotaatelipalmusunnuntaikävelykatuju hla- koristehedelmäkaramellimassatuotevalvontalaitteist o- testauslaboratoriokäyttökertatulitikkuviinapiiloho mo- kaasulasersädehoitokotikaljakimblemestaruussarjaku va- ristikkokilpajuoksuhiekka-aavikkoluonto-ohjelmauusinta- vaalikokousedustusmeno-paluuruuhkabussivuoropysäköinti- sakkolihakoukkuselkänahkavyöruusukasvimaamunajuust omaito- rasvaimunestepinta-alahuulipunakampelaverkkomahalasku- harjoitustyöaamukampapellavaöljykriisiapukeinolonk kalepo- lomarusketusrajatietoteollisuuskiinteistömarkkinoi nti- diplomi-insinööriopiskelijaperinnemaisema-arkkitehti- kilta-aktiivihiiliteräsbetonivalurautaristisiitoshärkä- pizzamaustevoipaperiroskapostimerkkisavusaunavasta protesti- marssivapautusliikevaihtoväliarvojoukkopakomatkaop as- koirakantakorttitaikatalvisotakunniajäsenetupuolik uiva- rehuvilja-aittakorpisuomaastohiihtoputkitiivistesilikoni- rintataskuvaraslähtöliukumiinakenttäkeitinvesihana saari- ryhmätyömyyrävuosikurssikirjapainopistetulotukivar sikenkä- kauppaopistoupseerikerhohuonepalveluammattikoulupo ika- tyttöenergiatalousaluelaajennustarvehierarkiakaavi o- suunnittelupäätöspäivävientisulkuporttiteoriapohja kunto- urheiluruutuässäpariluistelutyylituomaripelimies- voimisteluvideokulmakarvakuonokoppalakkipäämääräal ennus- tilataksimittarimatopurkkikeittoastiakaappipakasti n- yhdistelmälukkoseppähenkilötunnussanaleikkikalupak kipussi- eläinkoeponnistuslautakuntalakitekstiseikkailuleir i- telttakangaspuujalkasienipiirakkareseptivihkopakka us- muovikuularuiskumaalaustarvikevarastohyllymetrilak uavain- naulakkovartiopäällikkötasogeometriavirhevaihtosäh kökazoo- pillihousupukupellehyppylankakeräkaaliaivovuotosuo ja- vaatekappalemyyntitykkilavatanssiaskelmoottoripyör ä- koppisiemenperunapalstajakoviivaintegraalioperaatt ori- algebraoppilaitoskompleksilukusuoraveto-oikeusmurha- asevarikkopilttuu.
_________________ A good friend will bail you out of jail, but a best friend will be sitting right next to you, saying, "MAN! that was fun!"
yo, i like skaterboarding
|
March 18th, 2007, 2:03 pm |
|
 |
Kataraflower786
Wise DragonRider
Joined: December 23rd, 2007, 12:53 am Posts: 1085 Location: Somewhere over the rainbow...
Gender: Girl
|
 Re: long words
Taumatawhakatangihangakoauauotamateapokaiwhenuakitanatahu (85 letters long)
Pseudopseudohypoparathyroidism (30 letters)
Honorificabilitudinitatibus (27 letters long)
_________________

     Other Family~Silver's littlest, hippie sister with groovy bell bottoms, and flashy medallions. "Give peace a chance." -John Lennon "Love one another." -George Harrison (his last words) "I used to think anyone doing anything weird was weird. Now I know that it is the people that call others weird that are weird." -Paul McCartney "Everything government touches turns to cr@p." -Ringo Starr
|
June 28th, 2008, 8:14 pm |
|
 |
|