Last visit was: less than a minute ago It is currently February 9th, 2019, 3:36 pm

All times are UTC






 [ 24 posts ] 
 long words 
Author Message
New Peasant
New Peasant

Joined: January 14th, 2007, 7:06 pm
Posts: 31
Post long words
what is the longest word you know
mine is ,, antidisestablishmentarianism

_________________
ImageImageImage
ImageImageImage

BloodLight, The power i have is beyond imagination


January 17th, 2007, 7:42 pm Profile
Peasant Elder
Peasant Elder
User avatar

Joined: January 15th, 2007, 2:28 pm
Posts: 131
Gender: Guy
Affiliation: Elves
Post 
zandzeepsodemineraalwatersteenstralen 37 letters,
but it's dutch lol (my native language ;) )


January 17th, 2007, 8:31 pm Profile
Pink Dragon
Pink Dragon
User avatar

Joined: October 12th, 2006, 12:25 am
Posts: 6215
Location: MA
Gender: Guy
Affiliation: Dragonriders
Post 
Guardian Angel wrote:
zandzeepsodemineraalwatersteenstralen 37 letters,
but it's dutch lol (my native language ;) )
what does it mean?

_________________
Image
metal gear forever


January 17th, 2007, 8:32 pm Profile
Peasant Elder
Peasant Elder
User avatar

Joined: January 15th, 2007, 2:28 pm
Posts: 131
Gender: Guy
Affiliation: Elves
Post 
I have absolutely no idea, lol, I just happen to know
that that IS the longest word in our language..
Not the longest I know of, but actually the longest word.. :lol:


January 17th, 2007, 8:36 pm Profile
New Peasant
New Peasant

Joined: January 14th, 2007, 7:06 pm
Posts: 31
Post 
wow, that is a long word

_________________
ImageImageImage
ImageImageImage

BloodLight, The power i have is beyond imagination


January 18th, 2007, 4:05 pm Profile
DragonRider
DragonRider

Joined: October 17th, 2006, 5:56 pm
Posts: 854
Location: somewhere, there's no gravity, and common sense has died, guess where i am cause i don't have a clue
Post 
floccinaucinihilipilifition is the longest word in the english language
antidisestablishmentarianism is not actually a word...
just saying

_________________
Where the gods fear to tread
That where evil makes its bed
That is where they grow and grow
and that is where you must go
(\../)
(O.o)
(")(")
Help me take over the world!!!

we took a wrong turning
it's nobodies fault
we followed our hearts
and now we're lost
we kept on going
no thought of cost
and this is the consequence

please read and comment on my story
http://www.saphiraforums.com/en/viewtopic.php?t=3206

please read and comment on my songs
http://www.saphiraforums.com/en/viewtopic.php?t=4283

Aren't i demanding

after several painful attempts i stopped getting Vivi!!!
Image
Which Final Fantasy Character Are You?
Final Fantasy 7


January 18th, 2007, 5:19 pm Profile
Sovereign DragonRider
Sovereign DragonRider
User avatar

Joined: August 21st, 2006, 10:51 pm
Posts: 3802
Location: in the eye of the beholder
Gender: Girl
Affiliation: Elves
Post 
the longest word is actually 1909 letters long but it is not on wikipiedia and i dont feel like typing it but the deffinition is : A tryptophan synthetase A protein, an enzyme that has 267 amino acids : since the longest word is so long i will put anouther long word

floccinaucinhilpilification - means the estimation of a thing that is worthless

Quote:
antidisestablishmentarianism is not actually a word...


it is so a word it is in my dictionary!!! and its on wikipeidia if u do not belive me here is the link
http://en.wikipedia.org/wiki/Antidisestablishmentarianism


January 18th, 2007, 8:24 pm Profile
New Peasant
New Peasant

Joined: January 14th, 2007, 7:06 pm
Posts: 31
Post 
thank you for proving that my word was real :D. i donated 10 coins for that:D

_________________
ImageImageImage
ImageImageImage

BloodLight, The power i have is beyond imagination


January 18th, 2007, 9:35 pm Profile
DragonRider in Training
DragonRider in Training
User avatar

Joined: November 25th, 2006, 5:50 am
Posts: 634
Location: Would love to be at the races at the 24 hours of daytona...god it is that time of the year again????
Gender: Guy
Post 
supercalafigalistxbaladouish mary poppen's

_________________
Image
ImageTake the Magic: The Gathering 'What Color Are You?' Quiz.i zoom zoom! do you? Mazda 3's rock!


January 19th, 2007, 4:42 am Profile
Wise DragonRider
Wise DragonRider

Joined: July 26th, 2006, 8:45 am
Posts: 1229
Location: Somewhere scary, listening to MCR, SOAD and other emo bands. But not cutting myself..
Gender: Guy
Affiliation: Dwarves
Post 
thats not how you spell mary poppins lol

otorhinolaryngological (22 letters),
immunoelectrophoretically (25 letters),
psychophysicotherapeutics (25 letters),
thyroparathyroidectomized (25 letters),
pneumoencephalographically (26 letters),
radioimmunoelectrophoresis (26 letters),
psychoneuroendocrinological (27 letters)
hepaticocholangiogastrostomy (28 letters),
spectrophotofluorometrically (28 letters),
pseudopseudohypoparathyroidism (30 letters).
floccinaucinihilipilification (29 letters),

and anyway, wikipedia is not always right...

_________________
Arya Svit-kona wrote:

caterpillar SILVER I JUST NOTICED THE CHEST HAIR!!!!!!! :lol: :lol:


The Lovable Silv wrote:
LOL Ranga, you cannot steal my position as "Bullspit artist" so stop being so sarcastic haha!! Jking of course..


Image
The Lovechild of Valk and Wolverein

.[/color]


January 19th, 2007, 5:57 am Profile
DragonRider
DragonRider

Joined: October 17th, 2006, 5:56 pm
Posts: 854
Location: somewhere, there's no gravity, and common sense has died, guess where i am cause i don't have a clue
Post 
according to someone who knows a lot about languages and came to talk to us about said languages it's not a word...

_________________
Where the gods fear to tread
That where evil makes its bed
That is where they grow and grow
and that is where you must go
(\../)
(O.o)
(")(")
Help me take over the world!!!

we took a wrong turning
it's nobodies fault
we followed our hearts
and now we're lost
we kept on going
no thought of cost
and this is the consequence

please read and comment on my story
http://www.saphiraforums.com/en/viewtopic.php?t=3206

please read and comment on my songs
http://www.saphiraforums.com/en/viewtopic.php?t=4283

Aren't i demanding

after several painful attempts i stopped getting Vivi!!!
Image
Which Final Fantasy Character Are You?
Final Fantasy 7


January 19th, 2007, 4:36 pm Profile
Dragon Egg Carrier
Dragon Egg Carrier

Joined: December 20th, 2006, 5:37 pm
Posts: 153
Location: On a football field, playing football, or watching football.
Post 
NONE OF THOSE ARE IT. most arent even words. the longest word in the english language is:
Pnuemonoultramicroscopicsilacovolcanoconiosis. 45 letters. scientific for black lung disease.

_________________
Image
LT is the man.
If we knew all of gods reasons for doing things, then we would be god.
You cry, I cry
You laugh, I laugh
I fall off a bridge, you laugh even harder.
If your not going to say anything nice, at least make it funny.
Hey did you guys know I like football?
A good friend will bail you out of jail, but a best friend will be sitting right next to you, saying, "MAN! that was fun!"
Arya is HOT! (but not in the movie)
Never tell me the odds...


January 19th, 2007, 5:20 pm Profile
BAD EMAIL
BAD EMAIL

Joined: August 10th, 2006, 10:15 pm
Posts: 279
Location: where the side walk ends
Post 
I heard the same thing from my 7th grade L. Arts teacher

_________________
"Strength does not come from physical capsity. It comes from indomitable will." Ghandi

Image

Image
Which Final Fantasy Character Are You?
Final Fantasy


January 19th, 2007, 5:53 pm Profile
Wise DragonRider
Wise DragonRider

Joined: July 26th, 2006, 8:45 am
Posts: 1229
Location: Somewhere scary, listening to MCR, SOAD and other emo bands. But not cutting myself..
Gender: Guy
Affiliation: Dwarves
Post 
my friends say that antidisastablishmentarianism is a word, but they're full of it!

_________________
Arya Svit-kona wrote:

caterpillar SILVER I JUST NOTICED THE CHEST HAIR!!!!!!! :lol: :lol:


The Lovable Silv wrote:
LOL Ranga, you cannot steal my position as "Bullspit artist" so stop being so sarcastic haha!! Jking of course..


Image
The Lovechild of Valk and Wolverein

.[/color]


January 20th, 2007, 1:11 am Profile
RPG Team Head
RPG Team Head
User avatar

Joined: February 6th, 2006, 11:51 pm
Posts: 4527
Location: Dreaming.
Gender: Guy
Affiliation: Lamp Shade
Dragon: DrAgonPhD
Post 
Lopadotemachoselachogaleokranioleipsanodrimhypotrimmatosilphioparaomelitokatak
echymenokichlepikossyphophattoperisteralektryonoptekephalliokigklopeleiolagoiosira
iobaphetraganopterygon

189 letters lol


January 20th, 2007, 3:03 am Profile
DragonRider in Training
DragonRider in Training
User avatar

Joined: November 25th, 2006, 5:50 am
Posts: 634
Location: Would love to be at the races at the 24 hours of daytona...god it is that time of the year again????
Gender: Guy
Post 
tristadicaphiobia (sp)

_________________
Image
ImageTake the Magic: The Gathering 'What Color Are You?' Quiz.i zoom zoom! do you? Mazda 3's rock!


January 20th, 2007, 4:00 am Profile
Sovereign DragonRider
Sovereign DragonRider
User avatar

Joined: August 21st, 2006, 10:51 pm
Posts: 3802
Location: in the eye of the beholder
Gender: Girl
Affiliation: Elves
Post 
Fastfire21 wrote:
NONE OF THOSE ARE IT. most arent even words. the longest word in the english language is:
Pnuemonoultramicroscopicsilacovolcanoconiosis. 45 letters. scientific for black lung disease.


u must not have read my last post the longest word is 1909 letters long


January 21st, 2007, 2:01 am Profile
Wise DragonRider
Wise DragonRider
User avatar

Joined: August 21st, 2006, 10:04 am
Posts: 1196
Location: Somewhere in England wishing for good weather....
Gender: Girl
Affiliation: SF Rebels
Post 
Fastfire21 wrote:
NONE OF THOSE ARE IT. most arent even words. the longest word in the english language is:
Pnuemonoultramicroscopicsilacovolcanoconiosis. 45 letters. scientific for black lung disease.

actually it means the dust particles in the lung. or something along those lines not black lung deasise(unless tere the same thign then sori lol!!)

_________________
Oh No of course!You must have worked hands free, like Hey I'm the doctor I can save the universe using a kettle and some string, and look at me im wearing a vegetable- David Tennant


January 21st, 2007, 11:18 am Profile
New Peasant
New Peasant

Joined: January 14th, 2007, 7:06 pm
Posts: 31
Post 
btw, antidis..... is a word, cos microsoft word has it in its internal dictionary, if u spell it wrong it tell u how to spell it correctly, and if u spell it right it do not put a red line under it

_________________
ImageImageImage
ImageImageImage

BloodLight, The power i have is beyond imagination


January 21st, 2007, 12:16 pm Profile
RPG Team
RPG Team
User avatar

Joined: August 21st, 2006, 9:28 pm
Posts: 8122
Location: I don't know, how could you expect me to when it was you who brought me here!
Gender: Guy
Affiliation: Dragonriders
Dragon: Avadius
Post 
nordostersjakustartillerflygspaningssimulatoranlaggningsmarterielunderhallsuppfoljingsystemdisikussionsinlaggstorberedelse its a 130 letter word in swedish

_________________
Good:
Equinox Eris/Galedrim Aaron Ephidel Tvashtar Savania Incendia Radenya Zeuk Quasar Nainocaro Alex Archayac Sahara

Neutral:
Snare

Evil:
Crimson Dsurion Demondred "Destroyer of Hope" Solstus "Dragon of the Night"

Let your spirit flow in each and everyone one of us and may we bask in your forgiveness, love, and mercy.


January 21st, 2007, 11:40 pm Profile
Wise DragonRider
Wise DragonRider

Joined: March 17th, 2007, 5:12 pm
Posts: 1199
Location: Relient K concert
Post 
Pneumonoultramicroscopicsilicovolcanoconiosis

45 letters its some thing to do with lung disease

_________________
A good friend will bail you out of jail, but a best friend will be sitting right next to you, saying, "MAN! that was fun!"


yo, i like skaterboarding


March 18th, 2007, 1:54 pm Profile
Dragon Egg Carrier
Dragon Egg Carrier

Joined: December 8th, 2006, 1:27 am
Posts: 171
Post 
For short it's also Miner's Lung.
how about smiles, because there's a mile between the first and last letters.

_________________
There is nothing more dangerous than an enemy with nothing to lose... and that is exactly what I have become. -Eragon in Eragon
There are no failures, only opportunities, -Queen Savilla in The Outstretched Shadow
People fear what they don't understand.
There comes a time when everyone must do something they fear
Image
Which Final Fantasy Character Are You?
Final Fantasy 7


March 18th, 2007, 1:57 pm Profile
Wise DragonRider
Wise DragonRider

Joined: March 17th, 2007, 5:12 pm
Posts: 1199
Location: Relient K concert
Post 
REAL WORD....
Swedish
80 letters

kyyhkyslakkahillotaatelipalmusunnuntaikävelykatuju hla- koristehedelmäkaramellimassatuotevalvontalaitteist o- testauslaboratoriokäyttökertatulitikkuviinapiiloho mo- kaasulasersädehoitokotikaljakimblemestaruussarjaku va- ristikkokilpajuoksuhiekka-aavikkoluonto-ohjelmauusinta- vaalikokousedustusmeno-paluuruuhkabussivuoropysäköinti- sakkolihakoukkuselkänahkavyöruusukasvimaamunajuust omaito- rasvaimunestepinta-alahuulipunakampelaverkkomahalasku- harjoitustyöaamukampapellavaöljykriisiapukeinolonk kalepo- lomarusketusrajatietoteollisuuskiinteistömarkkinoi nti- diplomi-insinööriopiskelijaperinnemaisema-arkkitehti- kilta-aktiivihiiliteräsbetonivalurautaristisiitoshärkä- pizzamaustevoipaperiroskapostimerkkisavusaunavasta protesti- marssivapautusliikevaihtoväliarvojoukkopakomatkaop as- koirakantakorttitaikatalvisotakunniajäsenetupuolik uiva- rehuvilja-aittakorpisuomaastohiihtoputkitiivistesilikoni- rintataskuvaraslähtöliukumiinakenttäkeitinvesihana saari- ryhmätyömyyrävuosikurssikirjapainopistetulotukivar sikenkä- kauppaopistoupseerikerhohuonepalveluammattikoulupo ika- tyttöenergiatalousaluelaajennustarvehierarkiakaavi o- suunnittelupäätöspäivävientisulkuporttiteoriapohja kunto- urheiluruutuässäpariluistelutyylituomaripelimies- voimisteluvideokulmakarvakuonokoppalakkipäämääräal ennus- tilataksimittarimatopurkkikeittoastiakaappipakasti n- yhdistelmälukkoseppähenkilötunnussanaleikkikalupak kipussi- eläinkoeponnistuslautakuntalakitekstiseikkailuleir i- telttakangaspuujalkasienipiirakkareseptivihkopakka us- muovikuularuiskumaalaustarvikevarastohyllymetrilak uavain- naulakkovartiopäällikkötasogeometriavirhevaihtosäh kökazoo- pillihousupukupellehyppylankakeräkaaliaivovuotosuo ja- vaatekappalemyyntitykkilavatanssiaskelmoottoripyör ä- koppisiemenperunapalstajakoviivaintegraalioperaatt ori- algebraoppilaitoskompleksilukusuoraveto-oikeusmurha- asevarikkopilttuu.

_________________
A good friend will bail you out of jail, but a best friend will be sitting right next to you, saying, "MAN! that was fun!"


yo, i like skaterboarding


March 18th, 2007, 2:03 pm Profile
Wise DragonRider
Wise DragonRider
User avatar

Joined: December 23rd, 2007, 12:53 am
Posts: 1085
Location: Somewhere over the rainbow...
Gender: Girl
Post Re: long words
:shock: :shock: :shock: :shock: :shock: :shock: :shock:

Taumatawhakatangihangakoauauotamateapokaiwhenuakitanatahu
(85 letters long)

Pseudopseudohypoparathyroidism
(30 letters)

Honorificabilitudinitatibus
(27 letters long)

_________________
Image
ImageImageImageImageImage
Other Family~Silver's littlest, hippie sister with groovy bell bottoms, and flashy medallions.
"Give peace a chance." -John Lennon
"Love one another." -George Harrison (his last words)
"I used to think anyone doing anything weird was weird. Now I know that it is the people that call others weird that are weird." -Paul McCartney
"Everything government touches turns to cr@p." -Ringo Starr


June 28th, 2008, 8:14 pm Profile
Display posts from previous:  Sort by  
 Page 1 of 1  [ 24 posts ]

All times are UTC


Who is online

Users browsing this forum: HTTrack and 0 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Copyright © 2004 - 2012 SaphiraForums - Powered by phpBB © phpBB Group.
Template by Vjacheslav Trushkin - Modified by SaphiraForums.
Privacy Policy